Myxovirus (C-Term) anticorps

N° du produit ABIN634510

Cet anticorps Lapin Polyclonal détecte spécifiquement dans WB. Il présente une réactivité envers Virus.

Aperçu rapide pour Myxovirus (C-Term) anticorps (ABIN634510)

Antigène: Myxovirus

Reactivité: Virus

Hôte: Lapin

Clonalité: Polyclonal

Application: Western Blotting (WB)

Détail du produit

Épitope: C-Term

Specificité: Myxovirus antibody was raised against the C terminal of MX1

Réactivité croisée: Humain, Chien

Purification: Affinity purified

Immunogène: Myxovirus antibody was raised using the C terminal of MX1 corresponding to a region with amino acids KAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQFPG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Myxovirus Blocking Peptide, (ABIN939636), is also available for use as a blocking control in assays to test for specificity of this Myxovirus antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Myxovirus

Classe de substances: Virus

Sujet: In mouse, the interferon-inducible Mx protein is responsible for a specific antiviral state against influenza virus infection. MX1 is similar to the mouse protein as determined by its antigenic relatedness, induction conditions, physicochemical properties, and amino acid analysis. This cytoplasmic protein is a member of both the dynamin family and the family of large GTPases. In mouse, the interferon-inducible Mx protein is responsible for a specific antiviral state against influenza virus infection.

Poids moléculaire: 75 kDa (MW of target protein)